Recombinant Human LRRC57 Protein, GST-tagged
Cat.No. : | LRRC57-4650H |
Product Overview : | Human LRRC57 full-length ORF ( NP_694992.1, 1 a.a. - 239 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | LRRC57 (Leucine Rich Repeat Containing 57) is a Protein Coding gene. An important paralog of this gene is PIDD1. |
Molecular Mass : | 53.1 kDa |
AA Sequence : | MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKIESLPPLLIGKFTLLKSLSLNNNKLTVLPDEICNLKKLETLSLNNNHLRELPSTFGQLSALKTLSLSGNQLGALPPQLCSLRHLDVMDLSKNQIRSIPDSVGELQVIELNLNQNQISQISVKISCCPRLKILRLEENCLELSMLPQSILSDSQICLLAVEGNLFEIKKLRELEGYDKYMERFTATKKNFA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LRRC57 leucine rich repeat containing 57 [ Homo sapiens ] |
Official Symbol | LRRC57 |
Synonyms | LRRC57; leucine rich repeat containing 57; leucine-rich repeat-containing protein 57; FLJ36812; DKFZp686H1865; |
Gene ID | 255252 |
mRNA Refseq | NM_153260 |
Protein Refseq | NP_694992 |
UniProt ID | Q8N9N7 |
◆ Recombinant Proteins | ||
LRRC57-2563R | Recombinant Rhesus monkey LRRC57 Protein, His-tagged | +Inquiry |
Lrrc57-3838M | Recombinant Mouse Lrrc57 Protein, Myc/DDK-tagged | +Inquiry |
LRRC57-4650H | Recombinant Human LRRC57 Protein, GST-tagged | +Inquiry |
LRRC57-2383R | Recombinant Rhesus Macaque LRRC57 Protein, His (Fc)-Avi-tagged | +Inquiry |
LRRC57-3130R | Recombinant Rat LRRC57 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRRC57-1033HCL | Recombinant Human LRRC57 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LRRC57 Products
Required fields are marked with *
My Review for All LRRC57 Products
Required fields are marked with *
0
Inquiry Basket