Recombinant Human LRBA Protein (1267-1500 aa), His-tagged

Cat.No. : LRBA-631H
Product Overview : Recombinant Human LRBA Protein (1267-1500 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1267-1500 aa
Description : May be involved in coupling signal transduction and vesicle trafficking to enable polarized secretion and/or mbrane deposition of immune effector molecules.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 29.8 kDa
AA Sequence : PQPHRHVLEISRQHEQPGQGIAPDAVNGQRRDSRSTVFRIPEFNWSQMHQRLLTDLLFSIETDIQMWRSHSTKTVMDFVNSSDNVIFVHNTIHLISQVMDNMVMACGGILPLLSAATSATHELENIEPTQGLSIEASVTFLQRLISLVDVLIFASSLGFTEIEAEKSMSSGGILRQCLRLVCAVAVRNCLECQQHSQLKTRGDKALKPMHSLIPLGKSAAKSPVDIVTGGISPV
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name LRBA LPS responsive beige-like anchor protein [ Homo sapiens (human) ]
Official Symbol LRBA
Synonyms BGL; LBA; CDC4L; CVID8; LAB300;
Gene ID 987
mRNA Refseq NM_001199282
Protein Refseq NP_001186211
UniProt ID P50851

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LRBA Products

Required fields are marked with *

My Review for All LRBA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon