Recombinant Human LRBA Protein (1-251 aa), His-tagged

• Cat.No.: LRBA-632H
• Product Overview: Recombinant Human LRBA Protein (1-251 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-251 aa
• Description: May be involved in coupling signal transduction and vesicle trafficking to enable polarized secretion and/or mbrane deposition of immune effector molecules.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 31.6 kDa
• AA Sequence: MASEDNRVPSPPPTGDDGGGGGREETPTEGGALSLKPGLPIRGIRMKFAVLTGLVEVGEVSNRDIVETVFNLLVGGQFDLEMNFIIQEGESINCMVDLLEKCDITCQAEVWSMFTAILKKSIRNLQVCTEVGLVEKVLGKIEKVDNMIADLLVDMLGVLASYNLTVRELKLFFSKLQGDKGRWPPHAGKLLSVLKHMPQKYGPDAFFNFPGKSAAAIALPPIAKWPYQNGFTFHTWLRMDPVNNINVDKDK
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: LRBA LPS responsive beige-like anchor protein [ Homo sapiens (human) ]
• Official Symbol: LRBA
• Synonyms: BGL; LBA; CDC4L; CVID8; LAB300
• Gene ID: 987
• mRNA Refseq: NM_001199282
• Protein Refseq: NP_001186211
• UniProt ID: P50851