Recombinant Human LPCAT2 protein, GST-tagged

• Cat.No.: LPCAT2-1886H
• Product Overview: Recombinant Human LPCAT2 protein(340-544 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 340-544 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: EAGLVEFTKISRKLKLDWDGVRKHLDEYASIASSSKGGRIGIEEFAKYLKLPVSDVLRQLFALFDRNHDGSIDFREYVIGLAVLCNPSNTEEIIQVAFKLFDVDEDGYITEEEFSTILQASLGVPDLDVSGLFKEIAQGDSISYEEFKSFALKHPEYAKIFTTYLDLQTCHVFSLPKEVQTTPSTASNKVSPEKHEESTSDKKDD
• Purity: 98%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: LPCAT2 lysophosphatidylcholine acyltransferase 2 [ Homo sapiens ]
• Official Symbol: LPCAT2
• Synonyms: LPCAT2; lysophosphatidylcholine acyltransferase 2; acyltransferase like 1 , AYTL1; FLJ20481; LPCAT-2; LPC acyltransferase 2; acyltransferase like 1; acyltransferase-like 1; lysoPC acyltransferase 2; lyso-PAF acetyltransferase; acetyl-CoA:lyso-PAF acetyltransferase; 1-acylglycerophosphocholine O-acyltransferase; 1-alkylglycerophosphocholine O-acetyltransferase; acyl-CoA:lysophosphatidylcholine acyltransferase 2; lyso-platelet-activating factor (PAF) acetyltransferase; acetyl-CoA:lyso-platelet-activating factor acetyltransferase; AYTL1; LysoPAFAT; DKFZp686H22112
• Gene ID: 54947
• mRNA Refseq: NM_017839
• Protein Refseq: NP_060309
• MIM: 612040
• UniProt ID: Q7L5N7