Recombinant Human LPAL2 Protein, GST-tagged

Description :	Apolipoprotein(a) is the distinguishing protein moiety of lipoprotein(a), of which elevated plasma levels are correlated with an increased risk of atherosclerosis. This gene is similar to the lipoprotein, Lp(a) gene, but all transcripts produced by this gene contain a truncated open reading frame and are candidates for nonsense-mediated decay. Consequently, this gene is considered to be a pseudogene. Alternative splicing results in multiple transcript variants. [provided by RefSeq
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	14.6 kDa
AA Sequence :	MEHKEVVLLLLLFLKSAPTETGPSVQECYHSNGQSYRGTYFTTVTGRTCQAWSSMTPHQHSRTPEKYPNDGLISNYCRNPDCSAGPWCYTTDPNVRWEYCNLTRCSDDEGTVFVPLTVIPVPSLEDSFIQVA
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	LPAL2 lipoprotein(a) like 2, pseudogene [ Homo sapiens (human) ]
Official Symbol	LPAL2
Synonyms	LPAL2; lipoprotein(a) like 2, pseudogene; APOA2; APOAL; APOARGC; apo(a)rg-C; apolipoprotein (a) related gene C; apolipoprotein A-II; lipoprotein, Lp(a)-like 2, pseudogene
Gene ID	https://www.ncbi.nlm.nih.gov/gene/80350
MIM	611682
UniProt ID	Q16609