Recombinant Full Length Human LPAL2 Protein, GST-tagged

Cat.No. : LPAL2-5967HF
Product Overview : Human LPAL2 full-length ORF ( AAI66644.1, 1 a.a. - 132 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 132 amino acids
Description : Apolipoprotein(a) is the distinguishing protein moiety of lipoprotein(a), of which elevated plasma levels are correlated with an increased risk of atherosclerosis. This gene is similar to the lipoprotein, Lp(a) gene, but all transcripts produced by this gene contain a truncated open reading frame and are candidates for nonsense-mediated decay. Consequently, this gene is considered to be a pseudogene. Alternative splicing results in multiple transcript variants. [provided by RefSeq
Molecular Mass : 14.6 kDa
AA Sequence : MEHKEVVLLLLLFLKSAPTETGPSVQECYHSNGQSYRGTYFTTVTGRTCQAWSSMTPHQHSRTPEKYPNDGLISNYCRNPDCSAGPWCYTTDPNVRWEYCNLTRCSDDEGTVFVPLTVIPVPSLEDSFIQVA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LPAL2 lipoprotein(a) like 2, pseudogene [ Homo sapiens (human) ]
Official Symbol LPAL2
Synonyms LPAL2; lipoprotein(a) like 2, pseudogene; APOA2; APOAL; APOARGC; apo(a)rg-C; apolipoprotein (a) related gene C; apolipoprotein A-II; lipoprotein, Lp(a)-like 2, pseudogene
Gene ID 80350
MIM 611682
UniProt ID Q16609

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LPAL2 Products

Required fields are marked with *

My Review for All LPAL2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon