Recombinant Human LOXL2 Protein, GST-tagged

• Cat.No.: LOXL2-4731H
• Product Overview: Human LOXL2 partial ORF ( NP_002309, 675 a.a. - 773 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. [provided by RefSeq
• Molecular Mass: 36.63 kDa
• AA Sequence: NFGDQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNFEVAESDYSNNIMKCRSRYDGHRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQLSP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LOXL2 lysyl oxidase-like 2 [ Homo sapiens ]
• Official Symbol: LOXL2
• Synonyms: LOXL2; lysyl oxidase-like 2; lysyl oxidase homolog 2; WS9 14; lysyl oxidase related 2; lysyl oxidase-like protein 2; lysyl oxidase-related protein 2; lysyl oxidase-related protein WS9-14; LOR2; WS9-14
• Gene ID: 4017
• mRNA Refseq: NM_002318
• Protein Refseq: NP_002309
• MIM: 606663
• UniProt ID: Q9Y4K0