Recombinant Human LOC442028 Protein, GST-tagged

• Cat.No.: LOC442028-4782H
• Product Overview: Human LOC442028 full-length ORF ( AAH42429.1, 1 a.a. - 199 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: LOC442028 (Uncharacterized LOC442028) is an RNA Gene, and is affiliated with the ncRNA class.
• Molecular Mass: 47 kDa
• AA Sequence: MNCGGGGSSSLRPQIPATQGCWHLQQLRFHMVAHEVGVLAALTALQVVSGDGEGHLCGVQGALQPLLLGQEQVGLRSQRLHLTLQLRLPAVRVLQSLAHCARGVLLRALRQRLGLCGQLLALVPLPLRLVAVGEGLVVASIAVLEPLLQQVLGGAEAGGGQAGGRVGARVTGHVVLFAGQLAGRHCLRHGACRPPGPGE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LOC442028 uncharacterized LOC442028 [ Homo sapiens (human) ]
• Official Symbol: LOC442028
• Synonyms: LOC442028; uncharacterized LOC442028
• Gene ID: 442028