Recombinant Full Length Alcanivorax Borkumensis Alkane 1-Monooxygenase 1(Alkb1) Protein, His-Tagged
Cat.No. : | RFL3413AF |
Product Overview : | Recombinant Full Length Alcanivorax borkumensis Alkane 1-monooxygenase 1(alkB1) Protein (Q0VKZ3) (1-404aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Alcanivorax borkumensis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-404) |
Form : | Lyophilized powder |
AA Sequence : | MSENILTEPPRSDADNEGYVDRKRHLWILSVLWPATPIIGLYLVSQTGWSIWYGLVLILW YGLVPLIDTMLGEDYSNPPESVVPKLEQDRYYKVLTYLTVPIHYAALIISAWWVSTQPIG VFEFLALALSLGIVNGLALNTGHELGHKKETFDRWMAKLVLAVVGYGHFFIEHNKGHHRD VATPMDPATSRMGESIYTFSLREIPGAFKRAWGLEEQRLSRCGKSVWSLDNEVLQPMILT VVLYAALLAFFGPLMLIFLPIQMAFGWWQLTSANYIEHYGLLREKLPNGRYEHQKPHHSW NSNHVMSNLILFHLQRHSDHHAHPTRSYQSLRDFSDLPTLPTGYPGMFFVAFFPSWFRSL MDDRVMEWAHGDINKIQIQPGMREFYEQKFGVKGSESPDTTVAK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | alkB1 |
Synonyms | alkB1; ABO_2707; Alkane 1-monooxygenase 1; Alkane hydroxylase; AHs; Terminal alkane hydroxylase |
UniProt ID | Q0VKZ3 |
◆ Recombinant Proteins | ||
CD5-052H | Recombinant Human CD5 protein, hFc-Avi-tagged, Biotinylated | +Inquiry |
AACS-3338H | Recombinant Human AACS protein, His-tagged | +Inquiry |
RAB3A-4548R | Recombinant Rat RAB3A Protein, His (Fc)-Avi-tagged | +Inquiry |
SE0621-2783S | Recombinant Staphylococcus epidermidis ATCC 12228 SE0621 protein, His-tagged | +Inquiry |
ANXA4-167R | Recombinant Rhesus Macaque ANXA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
VTN-2H | Native Human monomeric vitronectin, Biotin labeled | +Inquiry |
F9-5405M | Native Mouse Coagulation Factor IX | +Inquiry |
DEF-196H | Native Human Defensins | +Inquiry |
AHSG-111H | Native Human Alpha 2 HS Glycoprotein | +Inquiry |
F2-5287M | Native Mouse Coagulation Factor II | +Inquiry |
◆ Cell & Tissue Lysates | ||
TFDP3-1130HCL | Recombinant Human TFDP3 293 Cell Lysate | +Inquiry |
NFKBIZ-3845HCL | Recombinant Human NFKBIZ 293 Cell Lysate | +Inquiry |
Kidney-262C | Cynomolgus monkey Kidney Lysate | +Inquiry |
RRS1-2138HCL | Recombinant Human RRS1 293 Cell Lysate | +Inquiry |
ADI1-9011HCL | Recombinant Human ADI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All alkB1 Products
Required fields are marked with *
My Review for All alkB1 Products
Required fields are marked with *
0
Inquiry Basket