Recombinant Human LMAN2 Protein, HIS-tagged

• Cat.No.: LMAN2-053H
• Product Overview: Recombinant Human LMAN2 fused with His tag at C-termina was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: HIS
• Description: This gene encodes a type I transmembrane lectin that shuttles between the endoplasmic reticulum, the Golgi apparatus and the plasma membrane. The encoded protein binds high mannose type glycoproteins and may facilitate their sorting, trafficking and quality control.
• Form: Lyophilized from a 0.2 µM filtered solution of 50mM TrisHCI,10mM GSH,pH8.0
• Molecular Mass: 32.7kD
• AA Sequence: DITDGNSEHLKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVMVNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEHTPDEESIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTGWRVDHHHHHH
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: LMAN2 lectin, mannose-binding 2 [ Homo sapiens ]
• Official Symbol: LMAN2
• Synonyms: LMAN2; lectin, mannose-binding 2; C5orf8, chromosome 5 open reading frame 8; vesicular integral-membrane protein VIP36; GP36B; VIP36; glycoprotein GP36b; vesicular integral protein of 36 kDa; vesicular integral-membrane protein 36; C5orf8
• Gene ID: 10960
• mRNA Refseq: NM_006816
• Protein Refseq: NP_006807
• MIM: 609551
• UniProt ID: Q12907