Recombinant Human LINGO1 Protein, His-tagged

• Cat.No.: LINGO1-001H
• Product Overview: Recombinant human LINGO1 (a non-glycosylated polypeptide chain containing 133 amino acids (241-337 a.a)) fused to a 36 amino acid His-tag at N-terminus was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 241-337 a.a.
• Description: Leucine Rich Repeat And Ig Domain Containing 1, also known as Lingo1 is primarily expressed in neuronal tissue, and most abundantly in the cortex. In addition, Lingo 1 is involved in the inhibition of axon regeneration all the way through a ternary complex formed with NgR1 (ligand-binding subunit) and p75 (signal transducing subunit). The inhibitory action is accomplished through RhoA-GTP upregulation in response to the presence of MOG, MAG or Nogo-66 in the central nervous system. Furthermore, LINGO-1 inhibits oligodendrocyte precursor differentiation as well as myelination, by a mechanism which also involves activation of RhoA, however it appears that it does not require 75 or NgR1.
• Molecular Mass: 15.1kDa
• AA Sequence: MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSLKVLEISHWPYLDTMTPNCLYGLNLTSLSITHCNLTAVPYLAVRHLVYLRFLNLSYNPISTIEGSMLHELLRLQEIQLVGGQLAVVEPYAFRGLNYL
• Purity: Greater than 90.0% as determined by SDS-PAGE.
• Storage: Store at 4 centigrade if entire vial will be used within 2-4 weeks. Store, frozen at -20 centigrade for longer periods of time.
  For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
  Avoid multiple freeze-thaw cycles.
• Concentration: 1mg/mL
• Storage Buffer: 20mM Tris-HCl buffer (pH 8.0) and 10% glycerol

Gene Information

• Gene Name: LINGO1
• Official Symbol: LINGO1 leucine rich repeat and Ig domain containing 1 [ Homo sapiens (human) ]
• Synonyms: Leucine Rich Repeat And Ig Domain Containing 1; LRRN6A; Leucine-Rich Repeat And Immunoglobulin Domain-Containing Protein 1; Leucine-Rich Repeat Neuronal Protein 1; Leucine Rich Repeat Neuronal 6A; LERN1; Leucine-Rich Repeat And Immunoglobulin-Like Domain-Containing Nogo Receptor-Interacting Protein 1; Leucine-Rich Repeat Neuronal Protein 6A; UNQ201; LERN1; Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1; LINGO1; leucine rich repeat and Ig domain containing 1; ERN1
• Gene ID: 84894
• mRNA Refseq: NM_001301186
• Protein Refseq: NP_001288115
• MIM: 609791
• UniProt ID: Q96FE5