Recombinant Human LIMS1

• Cat.No.: LIMS1-29952TH
• Product Overview: Recombinant full length Human LIMS1 with a N terminal proprietary tag; Predicted MWt 61.82 kDa.

Specification

• Description: The protein encoded by this gene is an adaptor protein which contains five LIM domains, or double zinc fingers. The protein is likely involved in integrin signaling through its LIM domain-mediated interaction with integrin-linked kinase, found in focal adhesion plaques. It is also thought to act as a bridge linking integrin-linked kinase to NCK adaptor protein 2, which is involved in growth factor receptor kinase signaling pathways. Its localization to the periphery of spreading cells also suggests that this protein may play a role in integrin-mediated cell adhesion or spreading. Several transcript variants encoding different isoforms have been found for this gene.
• Protein length: 325 amino acids
• Molecular Weight: 61.820kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Expressed in most tissues except in the brain.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQ CFQQFPEGLFYEFEGRKYCEHDFQMLFAPCCHQCGEFIIG RVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRP CHNREKARGLGKYICQKCHAIIDEQPLIFKNDPYHPDHFN CANCGKELTADARELKGELYCLPCHDKMGVPICGACRRPI EGRVVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKGLAYC ETHYNQLFGDVCFHCNRVIEGDVVSALNKAWCVNCFACST CNTKLTLKNKFVEFDMKPVCKKCYEKFPLELKKRLKKLAE TLGRK
• Sequence Similarities: Contains 5 LIM zinc-binding domains.
• Tag: Non

Gene Information

• Gene Name: LIMS1 LIM and senescent cell antigen-like domains 1 [ Homo sapiens ]
• Official Symbol: LIMS1
• Synonyms: LIMS1; LIM and senescent cell antigen-like domains 1; LIM and senescent cell antigen-like-containing domain protein 1; PINCH; PINCH1
• Gene ID: 3987
• mRNA Refseq: NM_001193482
• Protein Refseq: NP_001180411
• MIM: 602567
• Uniprot ID: P48059
• Chromosome Location: 2q12.3
• Pathway: Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-extracellular matrix interactions, organism-specific biosystem; Regulation of cytoskeletal remodeling and cell spreading by IPP complex components, organism-specific biosystem
• Function: metal ion binding; protein binding; zinc ion binding