Recombinant Human LILRA2, His-tagged

• Cat.No.: LILRA2-114H
• Product Overview: Recombinant Human Leukocyte Immunoglobulin-Like Receptor Subfamily A Member 2/LILRA2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gly24-Ser420) of Human LILRA2 fused with a polyhistidine tag at the C-terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 24-420 a.a.
• Description: Leukocyte Immunoglobulin-Like Receptor Subfamily A Member 2 (LILRA2) is a single-pass type I membrane protein. LILRA2 is expressed predominantly on monocytes and B cells, and at lower levels on dendritic cells and natural killer cells. LILRA2 contains four Ig-like C2-type domains, with short cytoplasmic domains lacking an immunoreceptor tyrosine-based inhibitory motif (ITIM) and with transmembrane regions containing a charged arginine residue, may initiate stimulatory cascades. LILRA2 does not bind class I MHC antigens.
• AA Sequence: GHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKSASWVRRIQEPGKNGQFPIPSIT WEHAGRYHCQYYSHNHSSEYSDPLELVVTGAYSKPTLSALPSPVVTLGGNVTLQCVSQVAFDGFI LCKEGEDEHPQRLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVP GVSKKPSLSVQPGPMVAPGESLTLQCVSDVGYDRFVLYKEGERDFLQRPGWQPQAGLSQANFTLG PVSPSHGGQYRCYSAHNLSSEWSAPSDPLDILITGQFYDRPSLSVQPVPTVAPGKNVTLLCQSRG QFHTFLLTKEGAGHPPLHLRSEHQAQQNQAEFRMGPVTSAHVGTYRCYSSLSSNPYLLSLPSDPL ELVVSASVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.

Gene Information

• Gene Name: LILRA2 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 2 [ Homo sapiens ]
• Official Symbol: LILRA2
• Synonyms: LILRA2; leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 2; leukocyte immunoglobulin-like receptor subfamily A member 2; CD85h; ILT1; LIR 7; LIR7; ILT-1; immunoglobulin-like transcript 1; CD85 antigen-like family member H; leukocyte immunoglobulin-like receptor 7; leukocyte immunoglobulin-like receptor subfamily A member 2 soluble; CD85H; LIR-7
• Gene ID: 11027
• mRNA Refseq: NM_001130917
• Protein Refseq: NP_001124389
• MIM: 604812
• UniProt ID: Q8N149
• Chromosome Location: 19q13.4
• Pathway: Osteoclast differentiation, organism-specific biosystem; Osteoclast differentiation, conserved biosystem
• Function: antigen binding; receptor activity