Recombinant Human LGALS13 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | LGALS13-6270H |
Product Overview : | LGALS13 MS Standard C13 and N15-labeled recombinant protein (NP_037400) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene has lysophospholipase activity. It is composed of two identical subunits which are held together by disulfide bonds. This protein has structural similarity to several members of the beta-galactoside-binding S-type lectin family. |
Molecular Mass : | 16.1 kDa |
AA Sequence : | MSSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDMDEDSDIAFRFRVHFGNHVVMNRREFGIWMLEETTDYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | LGALS13 galectin 13 [ Homo sapiens (human) ] |
Official Symbol | LGALS13 |
Synonyms | LGALS13; lectin, galactoside-binding, soluble, 13; galactoside-binding soluble lectin 13; galectin 13; PLAC8; PP13; gal-13; galectin-13; placental protein 13; placental tissue protein 13; beta-galactoside-binding lectin; GAL13; |
Gene ID | 29124 |
mRNA Refseq | NM_013268 |
Protein Refseq | NP_037400 |
MIM | 608717 |
UniProt ID | Q9UHV8 |
◆ Recombinant Proteins | ||
LGALS13-133H | Recombinant Human LGALS13 Protein (Ser2-Asn139), N-His tagged, Animal-free, Carrier-free | +Inquiry |
LGALS13-458H | Recombinant Human Lectin, Galactoside-Binding, Soluble, 13 | +Inquiry |
LGALS13-2493H | Recombinant human LGALS13, His-tagged | +Inquiry |
LGALS13-6270H | Recombinant Human LGALS13 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LGALS13-4220H | Recombinant Human LGALS13 Protein (Met1-Asn139), N-GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LGALS13-4768HCL | Recombinant Human LGALS13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LGALS13 Products
Required fields are marked with *
My Review for All LGALS13 Products
Required fields are marked with *
0
Inquiry Basket