Recombinant Human LFNG

• Cat.No.: LFNG-29854TH
• Product Overview: Recombinant full length Human Lunatic Fringe, isoform 2 with N terminal proprietary tag; Predicted MW 53.24 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 250 amino acids
• Description: This gene is a member of the fringe gene family which also includes radical and manic fringe genes. They all encode evolutionarily conserved glycosyltransferases that act in the Notch signaling pathway to define boundaries during embryonic development. While their genomic structure is distinct from other glycosyltransferases, fringe proteins have a fucose-specific beta-1,3-N-acetylglucosaminyltransferase activity that leads to elongation of O-linked fucose residues on Notch, which alters Notch signaling. This gene product is predicted to be a single-pass type II Golgi membrane protein but it may also be secreted and proteolytically processed like the related proteins in mouse and Drosophila (PMID: 9187150). Mutations in this gene have been associated with autosomal recessive spondylocostal dysostosis 3. Multiple transcript variants encoding different isoforms have been found for this gene.
• Molecular Weight: 53.240kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MTPGRCCLAADIQVETFIFTDGEDEALARHTGNVVITNCS AAHSRQALSCKMAVEYDRFIESGRKWFCHVDDDNYVNLRA LLRLLASYPHTRDVYVGKPSLDRPIQAMERVSENKVRPVH FWFATGGAGFCISRGLALKMSPWASGGHFMNTAERIRLPD DCTIGYIVEALLGVPLIRSGLFHSHLENLQQVPTSELHEQ VTLSYGMFENKRNAVHVKGPFSVEADPSRFRSIHCHLYPD TPWCPRTAIF
• Sequence Similarities: Belongs to the glycosyltransferase 31 family.

Gene Information

• Gene Name: LFNG LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase [ Homo sapiens ]
• Official Symbol: LFNG
• Synonyms: LFNG; LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase; lunatic fringe (Drosophila) homolog , lunatic fringe homolog (Drosophila); beta-1,3-N-acetylglucosaminyltransferase lunatic fringe; SCDO3
• Gene ID: 3955
• mRNA Refseq: NM_001040167
• Protein Refseq: NP_001035257
• MIM: 602576
• Uniprot ID: Q8NES3
• Chromosome Location: 7p22.3
• Pathway: Delta-Notch Signaling Pathway, organism-specific biosystem; Notch signaling pathway, organism-specific biosystem; Notch signaling pathway, conserved biosystem; Other types of O-glycan biosynthesis, organism-specific biosystem; Other types of O-glycan biosynthesis, conserved biosystem
• Function: O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase activity; molecular_function; transferase activity, transferring glycosyl groups