Recombinant Human LEP, StrepII-tagged

Cat.No. : LEP-277H
Product Overview : Purified, full-length human recombinant LEP protein (amino acids 22-167, 146 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 16.0 kDa. (Accession NP_000221; UniProt P41159)
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Strep II
Protein Length : 22-167, 146 a.a.
Description : LEP is a protein that is secreted by white adipocytes, and which plays a major role in the regulation of body weight. This protein, which acts through the leptin receptor, functions as part of a signaling pathway that can inhibit food intake and/or regulate energy expenditure to maintain constancy of the adipose mass. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis and wound healing. LEP belongs to the leptin family.
Form : Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free)
AA Sequence : VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQ ISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
Endotoxin : <0.1 eu per μg protein by lal
Purity : >90% by SDS-PAGE
Storage : 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles
Reconstitution : Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml
Gene Name LEP leptin [ Homo sapiens ]
Official Symbol LEP
Synonyms LEP; leptin; leptin (murine obesity homolog) , leptin (obesity homolog, mouse) , OB, OBS; obese protein; obesity factor; obese, mouse, homolog of; leptin (murine obesity homolog); leptin (obesity homolog, mouse); OB; OBS; FLJ94114;
Gene ID 3952
mRNA Refseq NM_000230
Protein Refseq NP_000221
UniProt ID P41159
Chromosome Location 7q31
Pathway Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; Adipogenesis, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Developmental Biology, organism-specific biosystem; Diabetes pathways, organism-specific biosystem;
Function growth factor activity; hormone activity; peptide hormone receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LEP Products

Required fields are marked with *

My Review for All LEP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon