Recombinant Human LEP, StrepII-tagged
Cat.No. : | LEP-277H |
Product Overview : | Purified, full-length human recombinant LEP protein (amino acids 22-167, 146 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 16.0 kDa. (Accession NP_000221; UniProt P41159) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 22-167, 146 a.a. |
Description : | LEP is a protein that is secreted by white adipocytes, and which plays a major role in the regulation of body weight. This protein, which acts through the leptin receptor, functions as part of a signaling pathway that can inhibit food intake and/or regulate energy expenditure to maintain constancy of the adipose mass. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis and wound healing. LEP belongs to the leptin family. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free) |
AA Sequence : | VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQ ISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC |
Endotoxin : | <0.1 eu per μg protein by lal |
Purity : | >90% by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml |
Gene Name | LEP leptin [ Homo sapiens ] |
Official Symbol | LEP |
Synonyms | LEP; leptin; leptin (murine obesity homolog) , leptin (obesity homolog, mouse) , OB, OBS; obese protein; obesity factor; obese, mouse, homolog of; leptin (murine obesity homolog); leptin (obesity homolog, mouse); OB; OBS; FLJ94114; |
Gene ID | 3952 |
mRNA Refseq | NM_000230 |
Protein Refseq | NP_000221 |
UniProt ID | P41159 |
Chromosome Location | 7q31 |
Pathway | Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; Adipogenesis, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Developmental Biology, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; |
Function | growth factor activity; hormone activity; peptide hormone receptor binding; |
◆ Recombinant Proteins | ||
LEP-0610H | Recombinant Human LEP Protein (Val22-Cys167), Tag Free | +Inquiry |
LEP-21O | Recombinant Ovine Leptin, Antagonist Triple Mutant | +Inquiry |
LEP-277H | Recombinant Human LEP, StrepII-tagged | +Inquiry |
LEP-3032R | Recombinant Rat LEP Protein, His (Fc)-Avi-tagged | +Inquiry |
Lep-6933M | Recombinant Mouse Leptin | +Inquiry |
◆ Native Proteins | ||
LEP-27641TH | Native Human LEP | +Inquiry |
◆ Cell & Tissue Lysates | ||
LEP-4773HCL | Recombinant Human LEP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LEP Products
Required fields are marked with *
My Review for All LEP Products
Required fields are marked with *
0
Inquiry Basket