Recombinant Human LEF1 protein, GST-tagged

Cat.No. : LEF1-301549H
Product Overview : Recombinant Human LEF1 (1-98 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met1-Asp98
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPD
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name LEF1 lymphoid enhancer-binding factor 1 [ Homo sapiens ]
Official Symbol LEF1
Synonyms LEF1; lymphoid enhancer-binding factor 1; TCF1ALPHA; TCF7L3; TCF10; TCF1-alpha; T cell-specific transcription factor 1-alpha; LEF-1; FLJ46390; DKFZp586H0919;
Gene ID 51176
mRNA Refseq NM_001130713
Protein Refseq NP_001124185
UniProt ID Q9UJU2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LEF1 Products

Required fields are marked with *

My Review for All LEF1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon