Recombinant Human LDLR protein(31-100 aa), C-His-tagged

• Cat.No.: LDLR-2506H
• Product Overview: Recombinant Human LDLR protein(P01130)(31-100 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 31-100 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: EFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSD
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: LDLR low density lipoprotein receptor [ Homo sapiens ]
• Official Symbol: LDLR
• Synonyms: LDLR; low density lipoprotein receptor; low-density lipoprotein receptor; familial hypercholesterolemia; LDL receptor; low-density lipoprotein receptor class A domain-containing protein 3; FH; FHC; LDLCQ2
• Gene ID: 3949
• mRNA Refseq: NM_000527
• Protein Refseq: NP_000518
• MIM: 606945
• UniProt ID: P01130