Recombinant Human LCN1 protein(31-100 aa), C-His-tagged

• Cat.No.: LCN1-2719H
• Product Overview: Recombinant Human LCN1 protein(P31025)(31-100 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 31-100 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: VSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGRCQEVKAVLEKTDEPGKYTADGG
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: LCN1 lipocalin 1 [ Homo sapiens ]
• Official Symbol: LCN1
• Synonyms: LCN1; lipocalin 1; lipocalin 1 (protein migrating faster than albumin, tear prealbumin) , lipocalin 1 (tear prealbumin); lipocalin-1; lipocalin 1 like 2; MGC71975; PMFA; tear lipocalin; tear prealbumin; TLC; TP; VEGP; Von Ebner gland protein; VEG protein; lipocalin 1 (tear prealbumin); protein migrating faster than albumin
• Gene ID: 3933
• mRNA Refseq: NM_001252618
• Protein Refseq: NP_001239547
• MIM: 151675
• UniProt ID: P31025