Recombinant Human LASP1 Protein (1-243 aa), GST-tagged

• Cat.No.: LASP1-1206H
• Product Overview: Recombinant Human LASP1 Protein (1-243 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Transport. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: 1-243 aa
• Description: Plays an important role in the regulation of dynamic actin-based, cytoskeletal activities. Agonist-dependent changes in LASP1 phosphorylation may also serve to regulate actin-associated ion transport activities, not only in the parietal cell but also in certain other F-actin-rich secretory epithelial cell types.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 54.8 kDa
• AA Sequence: MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGT
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: LASP1 LIM and SH3 protein 1 [ Homo sapiens ]
• Official Symbol: LASP1
• Synonyms: LASP1; Lasp 1; MLN50; MLN 50; Lasp-1
• Gene ID: 3927
• mRNA Refseq: NM_006148
• Protein Refseq: NP_006139
• MIM: 602920
• UniProt ID: Q14847