Recombinant Human LAMTOR2, His-tagged

• Cat.No.: LAMTOR2-31332TH
• Product Overview: Recombinant full length Human robld3 with an N terminal His tag; 149 amino acids with the tag, predicted mwt: 16 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 125 amino acids
• Description: The product of this gene is highly conserved with a mouse protein associated with the cytoplasmic face of late endosomes and lysosomes. The mouse protein interacts with MAPK scaffold protein 1, a component of the mitogen-activated protein kinase pathway. In humans, a mutation in this gene has been associated with a primary immunodeficiency syndrome, and suggests a role for this protein in endosomal biogenesis. Multiple transcript variants encoding different isoforms have been found for this gene.
• Conjugation: HIS
• Molecular Weight: 16.000kDa inclusive of tags
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSHMLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDNLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPLTQVAAS

Gene Information

• Gene Name: LAMTOR2 late endosomal/lysosomal adaptor, MAPK and MTOR activator 2 [ Homo sapiens ]
• Official Symbol: LAMTOR2
• Synonyms: LAMTOR2; late endosomal/lysosomal adaptor, MAPK and MTOR activator 2; roadblock domain containing 3 , ROBLD3; ragulator complex protein LAMTOR2; ENDAP; endosomal adaptor protein; MAPBPIP; MAPKSP1 adaptor protein; MAPKSP1AP; mitogen activated protein bindi
• Gene ID: 28956
• mRNA Refseq: NM_001145264
• Protein Refseq: NP_001138736
• MIM: 610389
• Uniprot ID: Q9Y2Q5
• Chromosome Location: 1q22
• Function: protein binding