Recombinant Human Laminin α4, GST-tagged

• Cat.No.: LAMA4-6953H
• Product Overview: Human LAMA4full-length ORF ( AAH04241.1, 1 a.a. - 120 a.a.) recombinant protein withGST-tag at N-terminal.

Specification

• Cat. No.: LAMA4-6953H
• Description: Laminin subunitalpha-4 is a protein that in humans is encoded by the LAMA4 gene. Laminins, afamily of extracellular matrix glycoproteins, are the major noncollagenousconstituent of basement membranes. They have been implicated in a widevariety of biological processes including cell adhesion, differentiation,migration, signaling, neurite outgrowth and metastasis. Laminins are composedof 3 non identical chains: laminin alpha, beta and gamma (formerly A, B1, andB2, respectively) and they form a cruciform structure consisting of 3 shortarms, each formed by a different chain, and a long arm composed of all 3chains. Each laminin chain is a multidomain protein encoded by a distinctgene. Several isoforms of each chain have been described.
• Source: wheat germ
• MolecularMass: 38.94 kDa
• Sequence: MALSSAWRSVLPLWLLWSAACSRAASGDDNAFPFDIEGSSAVGRQDPPETSEPRVALGRLPPAAEVQCPCHCHPAGAPAPPRAVPHSSFSLSPPLSSPQCLESFTWARSVRKLEIKSFPL
• Purity: GlutathioneSepharose 4 Fast Flow
• Buffer: 50 mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Format: supplied in 50 mMTris-HCl, 10 mM reduced Glutathione, pH 8.0, and do not contain any known hazardingredient
• Quality ControlTesting: 12.5% SDS-PAGEStained with Coomassie Blue.
• Applications: Enzyme-linkedImmunoabsorbent Assay; Western Blot (Recombinant protein)
• Storage: Store at -80°C.Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: LAMA4 laminin, alpha 4 [ Homosapiens ]
• Official Symbol: LAMA4
• Synonyms: LAMA4;laminin, alpha 4; LAMA3; LAMA4*-1; DKFZp686D23145; Laminin-14 subunit alpha;Laminin-8 subunit alpha; Laminin-9 subunit alpha
• Gene ID: 3910
• mRNA Refseq: NM_001105206
• Protein Refseq: NP_001098676
• MIM: 600133
• UniProt ID: Q16363
• Chromosome Location: 6q21
• Pathway: extracellularmatrix structural constituent; receptor binding
• Function: Africantrypanosomiasis; Amoebiasis; ECM-receptor interaction; FOXM1 transcriptionfactor networ; Focal adhesion; Pathways in cancer; Small cell lung cancer;Toxoplasmosis