Recombinant Human LAMA5 protein(2381-2460 aa), C-His-tagged

• Cat.No.: LAMA5-2461H
• Product Overview: Recombinant Human LAMA5 protein(O15230)(2381-2460 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 2381-2460 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: LMDLREALNRAVDATREAQELNSRNQERLEEALQRKQELSRDNATLQATLHAARDTLASVFRLLHSLDQAKEELERLAAS

Gene Information

• Gene Name: LAMA5 laminin, alpha 5 [ Homo sapiens ]
• Official Symbol: LAMA5
• Synonyms: LAMA5; laminin, alpha 5; laminin subunit alpha-5; laminin alpha-5 chain; laminin-10 subunit alpha; laminin-11 subunit alpha; laminin-15 subunit alpha; KIAA1907
• Gene ID: 3911
• mRNA Refseq: NM_005560
• Protein Refseq: NP_005551
• MIM: 601033
• UniProt ID: O15230