Recombinant Human LAG3
Cat.No. : | LAG3-101H |
Product Overview : | Human LAG3 full-length ORF (AAH52589.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | Lymphocyte-activation protein 3 belongs to Ig superfamily and contains 4 extracellular Ig-like domains. The LAG3 gene contains 8 exons. The sequence data, exon/intron organization, and chromosomal localization all indicate a close relationship of LAG3 to CD4. |
Form : | Liquid |
Molecular Mass : | 39.1 kDa |
AA Sequence : | MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAA PGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAA VHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESF LFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTP PGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITGQPQVGKE |
Applications : | Antibody Production; Functional Study; Compound Screening |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | LAG3 lymphocyte-activation gene 3 [ Homo sapiens (human) ] |
Official Symbol | LAG3 |
Synonyms | LAG3; CD223; lymphocyte-activation gene 3; lymphocyte activation gene 3 protein |
Gene ID | 3902 |
mRNA Refseq | NM_002286 |
Protein Refseq | NP_002277 |
MIM | 153337 |
UniProt ID | P18627 |
Chromosome Location | 12p13.32 |
Function | MHC class II protein binding; antigen binding; transmembrane signaling receptor activity |
◆ Recombinant Proteins | ||
LAG3-3000R | Recombinant Rat LAG3 Protein, His (Fc)-Avi-tagged | +Inquiry |
LAG3-24H | Recombinant Human LAG3 Protein, C-6His-Avi tagged, Biotinylated | +Inquiry |
LAG3-1828C | Active Recombinant Cynomolgus LAG3 protein, Fc-tagged | +Inquiry |
Lag3-389M | Active Recombinant Mouse Lag3, Fc-tagged | +Inquiry |
LAG3-1260M | Acitve Recombinant Mouse LAG3 protein(Met1-Leu442) | +Inquiry |
◆ Cell & Tissue Lysates | ||
LAG3-941RCL | Recombinant Rat LAG3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LAG3 Products
Required fields are marked with *
My Review for All LAG3 Products
Required fields are marked with *
0
Inquiry Basket