Recombinant Human LAG3

• Cat.No.: LAG3-101H
• Product Overview: Human LAG3 full-length ORF (AAH52589.1) recombinant protein without tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Description: Lymphocyte-activation protein 3 belongs to Ig superfamily and contains 4 extracellular Ig-like domains. The LAG3 gene contains 8 exons. The sequence data, exon/intron organization, and chromosomal localization all indicate a close relationship of LAG3 to CD4.
• Form: Liquid
• Molecular Mass: 39.1 kDa
• AA Sequence: MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAA PGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAA VHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESF LFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTP PGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITGQPQVGKE
• Applications: Antibody Production; Functional Study; Compound Screening
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: LAG3 lymphocyte-activation gene 3 [ Homo sapiens (human) ]
• Official Symbol: LAG3
• Synonyms: LAG3; CD223; lymphocyte-activation gene 3; lymphocyte activation gene 3 protein
• Gene ID: 3902
• mRNA Refseq: NM_002286
• Protein Refseq: NP_002277
• MIM: 153337
• UniProt ID: P18627
• Chromosome Location: 12p13.32
• Function: MHC class II protein binding; antigen binding; transmembrane signaling receptor activity