Recombinant Human KRTAP5-6 Protein, GST-tagged
Cat.No. : | KRTAP5-6-4808H |
Product Overview : | Human KRTAP5-6 full-length ORF ( ADR83318.1, 1 a.a. - 50 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-50 a.a. |
Description : | KRTAP5-6 (Keratin Associated Protein 5-6) is a Protein Coding gene. Among its related pathways are Keratinization and Developmental Biology. |
Molecular Mass : | 5.5 kDa |
AA Sequence : | MGCCGCSQCSCCKPCYCSSGCGSSCCQSSCCKPCCSQASCCVPICCQCKI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KRTAP5-6 keratin associated protein 5-6 [ Homo sapiens (human) ] |
Official Symbol | KRTAP5-6 |
Synonyms | KRTAP5-6; keratin associated protein 5-6; KRTAP5.6; keratin-associated protein 5-6; keratin-associated protein 5.6; ultrahigh sulfur keratin-associated protein 5.6 |
Gene ID | 440023 |
mRNA Refseq | NM_001012416 |
Protein Refseq | NP_001012416 |
UniProt ID | Q6L8G9 |
◆ Recombinant Proteins | ||
KRTAP5-6-3304H | Recombinant Human KRTAP5-6 Protein, His (Fc)-Avi-tagged | +Inquiry |
KRTAP5-6-1585H | Recombinant Human KRTAP5-6 | +Inquiry |
KRTAP5-6-5826HF | Recombinant Full Length Human KRTAP5-6 Protein, GST-tagged | +Inquiry |
KRTAP5-6-4808H | Recombinant Human KRTAP5-6 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KRTAP5-6-4841HCL | Recombinant Human KRTAP5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KRTAP5-6 Products
Required fields are marked with *
My Review for All KRTAP5-6 Products
Required fields are marked with *
0
Inquiry Basket