Recombinant Full Length Human KRTAP5-6 Protein, GST-tagged

• Cat.No.: KRTAP5-6-5826HF
• Product Overview: Human KRTAP5-6 full-length ORF ( ADR83318.1, 1 a.a. - 50 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 50 amino acids
• Description: KRTAP5-6 (Keratin Associated Protein 5-6) is a Protein Coding gene. Among its related pathways are Keratinization and Developmental Biology.
• Molecular Mass: 5.5 kDa
• AA Sequence: MGCCGCSQCSCCKPCYCSSGCGSSCCQSSCCKPCCSQASCCVPICCQCKI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: KRTAP5-6 keratin associated protein 5-6 [ Homo sapiens (human) ]
• Official Symbol: KRTAP5-6
• Synonyms: KRTAP5-6; keratin associated protein 5-6; KRTAP5.6; keratin-associated protein 5-6; keratin-associated protein 5.6; ultrahigh sulfur keratin-associated protein 5.6
• Gene ID: 440023
• mRNA Refseq: NM_001012416
• Protein Refseq: NP_001012416
• UniProt ID: Q6L8G9