Recombinant Human KRTAP5-11 Protein, GST-tagged
Cat.No. : | KRTAP5-11-4809H |
Product Overview : | Human KRTAP5-11 full-length ORF ( AAI48464.1, 1 a.a. - 156 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-156 a.a. |
Description : | KRTAP5-11 (Keratin Associated Protein 5-11) is a Protein Coding gene. Among its related pathways are Keratinization and Developmental Biology. |
Molecular Mass : | 43.56 kDa |
AA Sequence : | MGCCGCSGGCGSGCGGCGSGSGGCGSGCGGCGSSCCVPICCCKPVCCCVPACSCSSCGSCGGSKGGCGSCGSSKGGCGSCGCSQSNCCKPCCSSSGCGSFCCQSSCSKPCCCQSSCCQSSCCKPCCCQSSCCQSSCFKPCCCQSSCCVPVCCQCKI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KRTAP5-11 keratin associated protein 5-11 [ Homo sapiens (human) ] |
Official Symbol | KRTAP5-11 |
Synonyms | KRTAP5-11; keratin associated protein 5-11; KRTAP5-5; KRTAP5-6; KRTAP5.11; keratin-associated protein 5-11; keratin associated protein 5-5; keratin-associated protein 5.11; ultrahigh sulfur keratin-associated protein 5.11 |
Gene ID | 440051 |
mRNA Refseq | NM_001005405 |
Protein Refseq | NP_001005405 |
UniProt ID | Q6L8G4 |
◆ Recombinant Proteins | ||
KRTAP5-11-5825HF | Recombinant Full Length Human KRTAP5-11 Protein, GST-tagged | +Inquiry |
KRTAP5-11-4809H | Recombinant Human KRTAP5-11 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KRTAP5-11 Products
Required fields are marked with *
My Review for All KRTAP5-11 Products
Required fields are marked with *
0
Inquiry Basket