Recombinant Full Length Human KRTAP5-11 Protein, GST-tagged

• Cat.No.: KRTAP5-11-5825HF
• Product Overview: Human KRTAP5-11 full-length ORF ( AAI48464.1, 1 a.a. - 156 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: KRTAP5-11 (Keratin Associated Protein 5-11) is a Protein Coding gene. Among its related pathways are Keratinization and Developmental Biology.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 43.56 kDa
• Protein length: 156 amino acids
• AA Sequence: MGCCGCSGGCGSGCGGCGSGSGGCGSGCGGCGSSCCVPICCCKPVCCCVPACSCSSCGSCGGSKGGCGSCGSSKGGCGSCGCSQSNCCKPCCSSSGCGSFCCQSSCSKPCCCQSSCCQSSCCKPCCCQSSCCQSSCFKPCCCQSSCCVPVCCQCKI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: KRTAP5-11 keratin associated protein 5-11 [ Homo sapiens (human) ]
• Official Symbol: KRTAP5-11
• Synonyms: KRTAP5-11; keratin associated protein 5-11; KRTAP5-5; KRTAP5-6; KRTAP5.11; keratin-associated protein 5-11; keratin associated protein 5-5; keratin-associated protein 5.11; ultrahigh sulfur keratin-associated protein 5.11
• Gene ID: 440051
• mRNA Refseq: NM_001005405
• Protein Refseq: NP_001005405
• UniProt ID: Q6L8G4