Recombinant Human KRTAP3-2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: KRTAP3-2-3062H
• Product Overview: KRTAP3 MS Standard C13 and N15-labeled recombinant protein (NP_114165) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: This protein is a member of the keratin-associated protein (KAP) family. The KAP proteins form a matrix of keratin intermediate filaments which contribute to the structure of hair fibers. KAP family members appear to have unique, family-specific amino- and carboxyl-terminal regions and are subdivided into three multi-gene families according to amino acid composition: the high sulfur, the ultrahigh sulfur, and the high tyrosine/glycine KAPs. This protein is a member of the high sulfur KAP family and the gene is localized to a cluster of KAPs at 17q12-q21.
• Molecular Mass: 10.4 kDa
• AA Sequence: MDCCASRSCSVPTGPATTICSSDKSCRCGVCLPSTCPHTVWLLEPICCDNCPPPCHIPQPCVPTCFLLNSCQPTPGLETLNLTTFTQPCCEPCLPRGCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: KRTAP3-2 keratin associated protein 3-2 [ Homo sapiens (human) ]
• Official Symbol: KRTAP3-2
• Synonyms: KRTAP3-2; keratin associated protein 3-2; KAP3.2; KRTAP3.2; keratin-associated protein 3-2; high sulfur keratin-associated protein 3.2; keratin associated protein 3.2
• Gene ID: 83897
• mRNA Refseq: NM_031959
• Protein Refseq: NP_114165
• UniProt ID: Q9BYR7