Recombinant Human KRTAP11-1 Protein, GST-tagged

• Cat.No.: KRTAP11-1-4826H
• Product Overview: Human KRTAP11-1 full-length ORF ( ADR83477.1, 1 a.a. - 163 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1-163 a.a.
• Description: KRTAP11-1 (Keratin Associated Protein 11-1) is a Protein Coding gene. Among its related pathways are Keratinization and Developmental Biology. GO annotations related to this gene include structural molecule activity.
• Molecular Mass: 18 kDa
• AA Sequence: MSFNCSTRNCSSRPIGGRCIVPVAQVTTTSTTDADCLGGICLPSSFQTGSWLLDHCQETCCEPTACQPTCYRRTSCVSNPCQVTCSRQTTCISNPCSTTYSRPLTFVSSGCQPLGGISSVCQPVGGISTVCQPVGGVSTVCQPACGVSRTYQQSCVSSCRRTC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: KRTAP11-1 keratin associated protein 11-1 [ Homo sapiens ]
• Official Symbol: KRTAP11-1
• Synonyms: KRTAP11-1; keratin associated protein 11-1; keratin-associated protein 11-1; KAP11.1; high sulfur keratin-associated protein 11.1; HACL1; HACL-1
• Gene ID: 337880
• mRNA Refseq: NM_175858
• Protein Refseq: NP_787054
• MIM: 600064
• UniProt ID: Q8IUC1