Recombinant Full Length Human KRTAP11-1 Protein, GST-tagged

Cat.No. : KRTAP11-1-5798HF
Product Overview : Human KRTAP11-1 full-length ORF ( ADR83477.1, 1 a.a. - 163 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 163 amino acids
Description : KRTAP11-1 (Keratin Associated Protein 11-1) is a Protein Coding gene. Among its related pathways are Keratinization and Developmental Biology. GO annotations related to this gene include structural molecule activity.
Molecular Mass : 18 kDa
AA Sequence : MSFNCSTRNCSSRPIGGRCIVPVAQVTTTSTTDADCLGGICLPSSFQTGSWLLDHCQETCCEPTACQPTCYRRTSCVSNPCQVTCSRQTTCISNPCSTTYSRPLTFVSSGCQPLGGISSVCQPVGGISTVCQPVGGVSTVCQPACGVSRTYQQSCVSSCRRTC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name KRTAP11-1 keratin associated protein 11-1 [ Homo sapiens ]
Official Symbol KRTAP11-1
Synonyms KRTAP11-1; keratin associated protein 11-1; keratin-associated protein 11-1; KAP11.1; high sulfur keratin-associated protein 11.1; HACL1; HACL-1;
Gene ID 337880
mRNA Refseq NM_175858
Protein Refseq NP_787054
MIM 600064
UniProt ID Q8IUC1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All KRTAP11-1 Products

Required fields are marked with *

My Review for All KRTAP11-1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon