Recombinant Human KRT14 protein, GST-tagged

• Cat.No.: KRT14-30177H
• Product Overview: Recombinant Human KRT14 (262-472 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Gly262-Asn472
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: GQVGGDVNVEMDAAPGVDLSRILNEMRDQYEKMAEKNRKDAEEWFFTKTEELNREVATNSELVQSGKSEISELRRTMQNLEIELQSQLSMKASLENSLEETKGRYCMQLAQIQEMIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: KRT14 keratin 14 [ Homo sapiens ]
• Official Symbol: KRT14
• Synonyms: KRT14; keratin 14; EBS3, EBS4, keratin 14 (epidermolysis bullosa simplex, Dowling Meara, Koebner); keratin, type I cytoskeletal 14; epidermolysis bullosa simplex; Dowling Meara; Koebner; CK-14; keratin-14; cytokeratin 14; cytokeratin-14; keratin 14 (epidermolysis bullosa simplex, Dowling-Meara, Koebner); K14; NFJ; CK14; EBS3; EBS4
• Gene ID: 3861
• mRNA Refseq: NM_000526
• Protein Refseq: NP_000517
• MIM: 148066
• UniProt ID: P02533