Recombinant Human KRAS G12D protein, Avi Tag, Biotinylated
| Cat.No. : | KRAS-15H |
| Product Overview : | Recombinant human KRAS G12D protein (amino acids 1-185; G12D mutant variant of isoform 2B) with the N-terminal Avi Tag peptide and His-tag is produced in E. coli cells and site-specifically biotinylated at AviTag with BirA enzyme. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | Human KRAS protein is a small guanosine triphosphatase (GTPase) that is the component of the mitogen activated protein kinase (MAPK) signaling pathway. High occurrences of KRAS mutations in some types of cancers make KRAS one of the most important targets in oncology for drug development. The four most frequent KRAS mutations are G12D, G12V, G13D, and G12C. |
| Source : | E. coli |
| Species : | Human |
| Tag : | Avi |
| Protein length : | 1-185 |
| AA Sequence : | MGSHHHHHHHHSNGLNDIFEAQKIEWHEMTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC |
| Purity : | > 90% by Coomassie staining |
| Notes : | This product is for laboratory research use only. |
| Storage : | Storage is recommended at -20 centigrade for longer periods of time. |
| Concentration : | 1.0 mg/mL by A280 |
| Storage Buffer : | 20 mM HEPES, pH 7.5, 100 mM NaCl, 1 mM MgCl2, 1 mM 2-mercapthoethanol, 10% glycerol. |
| Shipping : | Product requires shipping on ice packs. |
| Gene Name | KRAS KRAS proto-oncogene, GTPase [ Homo sapiens (human) ] |
| Official Symbol | KRAS |
| Synonyms | KRAS; KRAS proto-oncogene, GTPase; NS; NS3; OES; CFC2; RALD; K-Ras; KRAS1; KRAS2; RASK2; KI-RAS; C-K-RAS; K-RAS2A; K-RAS2B; K-RAS4A; K-RAS4B; K-Ras 2; 'C-K-RAS; c-Ki-ras; c-Ki-ras2; GTPase KRas; K-ras p21 protein; Kirsten rat sarcoma viral oncogene homolog; Kirsten rat sarcoma viral proto-oncogene; PR310 c-K-ras oncogene; c-Kirsten-ras protein; cellular c-Ki-ras2 proto-oncogene; cellular transforming proto-oncogene; oncogene KRAS2; proto-oncogene GTPase; transforming protein p21; v-Ki-ras2 Kirsten rat sarcoma 2 viral oncogene homolog; EC 3.6.5.11; KRAS G12D |
| Gene ID | 3845 |
| mRNA Refseq | NM_033360 |
| Protein Refseq | NP_203524 |
| MIM | 190070 |
| UniProt ID | P01116 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KRAS Products
Required fields are marked with *
My Review for All KRAS Products
Required fields are marked with *
0
Inquiry Basket
