Recombinant Human KRAS G12C Protein, AviTag™, Biotinylated

Cat.No. : KRAS-09H
Product Overview : Recombinant human KRAS G12C protein (amino acids 1-185; G12C mutant variant of isoform 2B) with the N-terminal AviTag™ peptide and His-tag is produced in E. coli cells and site-specifically biotinylated at AviTag with BirA enzyme.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Avi
Protein Length : 1-185
Description : Human KRAS protein is a small guanosine triphosphatase (GTPase) that is the component of the mitogen activated protein kinase (MAPK) signaling pathway. High occurrences of KRAS mutations in some types of cancers make KRAS one of the most important targets in oncology for drug development. The four most frequent KRAS mutations are G12D, G12V, G13D, and G12C.
AA Sequence : MGSHHHHHHHHSNGLNDIFEAQKIEWHEMTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC
Purity : > 90% by Coomassie staining
Notes : This product is for laboratory research use only.
Storage : Storage is recommended at -20 centigrade for longer periods of time.
Concentration : 1.0 mg/mL by A280
Storage Buffer : 20 mM HEPES, pH 7.5, 100 mM NaCl, 1 mM MgCl2, 1 mM 2-mercapthoethanol, 10% glycerol.
Shipping : Product requires shipping on ice packs.
Gene Name KRAS KRAS proto-oncogene, GTPase [ Homo sapiens (human) ]
Official Symbol KRAS
Synonyms KRAS; KRAS proto-oncogene, GTPase; NS; NS3; OES; CFC2; RALD; K-Ras; KRAS1; KRAS2; RASK2; KI-RAS; C-K-RAS; K-RAS2A; K-RAS2B; K-RAS4A; K-RAS4B; K-Ras 2; 'C-K-RAS; c-Ki-ras; c-Ki-ras2; GTPase KRas; K-ras p21 protein; Kirsten rat sarcoma viral oncogene homolog; Kirsten rat sarcoma viral proto-oncogene; PR310 c-K-ras oncogene; c-Kirsten-ras protein; cellular c-Ki-ras2 proto-oncogene; cellular transforming proto-oncogene; oncogene KRAS2; proto-oncogene GTPase; transforming protein p21; v-Ki-ras2 Kirsten rat sarcoma 2 viral oncogene homolog; EC 3.6.5.10; KRAS G12C
Gene ID 3845
mRNA Refseq NM_033360
Protein Refseq NP_203524
MIM 190070
UniProt ID P01116

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All KRAS Products

Required fields are marked with *

My Review for All KRAS Products

Required fields are marked with *

0

Inquiry Basket

cartIcon