Recombinant Human KNG1 protein, T7/His-tagged

• Cat.No.: KNG1-70H
• Product Overview: Recombinant Full-length heavy chain domain (HMWK) of human KNG1 cDNA (19 – 380 aa, derived from BC060039) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFQESQSEEIDCNDKDLFKAVDAALKKYNSQNQSNNQFVLYRITEATK TVGSDTFYSFKYEIKEGDCPVQSGKTWQDCEYKDAAKAATGECTATVGKRSSTKFSVATQTCQITPAEGPVVTAQ YDCLGCVHPISTQSPDLEPILRHGIQYFNNNTQHSSLFMLNEVKRAQRQVVAGLNFRMTYSIVQTNCSKENFLFL TPDCKSLWNGDTGECTDNAYIDIQLRIASFSQNCDIYPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKL NAENNATFYFKIDNVKKARVQVVAGKKYFIDFVARETTCSKESNEELTESCETKKLGQSLDCNAEVYVVPWEKKI YPTVNCQPLGMISLMK
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro KNG1 H chain mediated endothelial cell differentiation / migration activities regulation study with this protein as either coating matrix protein or as soluble factor.2. May be used for KNG1 H chain protein – protein interaction assay.3. May be used as enzymatic substrate for various proteases.4. May be used for specific antibody production.
• Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.

Gene Information

• Gene Name: KNG1 kininogen 1 [ Homo sapiens ]
• Official Symbol: KNG1
• Synonyms: KNG1; kininogen 1; BDK, kininogen , KNG; kininogen-1; alpha 2 thiol proteinase inhibitor; bradykinin; HMWK; fitzgerald factor; high molecular weight kininogen; alpha-2-thiol proteinase inhibitor; williams-Fitzgerald-Flaujeac factor; BDK; KNG
• Gene ID: 3827
• mRNA Refseq: NM_000893
• Protein Refseq: NP_000884
• MIM: 612358
• UniProt ID: P01042
• Chromosome Location: 3q21-qter
• Pathway: ACE Inhibitor Pathway, organism-specific biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Complement and Coagulation Cascades, organism-specific biosystem; Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem
• Function: cysteine-type endopeptidase inhibitor activity; heparin binding; peptidase inhibitor activity; receptor binding; zinc ion binding