Recombinant Human KLRC3 Protein, GST-tagged

• Cat.No.: KLRC3-4913H
• Product Overview: Human KLRC3 partial ORF ( NP_002252, 132 a.a. - 240 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. KLRC3 is a member of the NKG2 group which are expressed primarily in natural killer (NK) cells and encodes a family of transmembrane proteins characterized by a type II membrane orientation (extracellular C terminus) and the presence of a C-type lectin domain. The NKG2 gene family is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed on NK cells. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 37.73 kDa
• AA Sequence: GKERRTWEESLQACASKNSSSLLSIDNEEEMKFLASILPSSWIGVFRNSSHHPWVTINGLAFKHEIKDSDHAERNCAMLHVRGLISDQCGSSRIIRRGFIMLTRLVLNS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: KLRC3 killer cell lectin-like receptor subfamily C, member 3 [ Homo sapiens ]
• Official Symbol: KLRC3
• Synonyms: KLRC3; killer cell lectin-like receptor subfamily C, member 3; NKG2-E type II integral membrane protein; NKG2 E; NK cell receptor E; NKG2-E-activating NK receptor; NKG2E; NKG2-E
• Gene ID: 3823
• mRNA Refseq: NM_002261
• Protein Refseq: NP_002252
• MIM: 602892
• UniProt ID: Q07444