Recombinant Human KLRA1P Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : KLRA1P-2202H
Product Overview : KLRA1 MS Standard C13 and N15-labeled recombinant protein (NP_006602) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Myc&DDK
Description : KLRA1P (Killer Cell Lectin Like Receptor A1, Pseudogene) is a Pseudogene. Among its related pathways are Immune response Role of DAP12 receptors in NK cells.
Molecular Mass : 25.5 kDa
AA Sequence : MNDQGEIYSTLRFLQSPSESQNRLRPDDTQRPGKTDDKEFSVPWHLIAVTLGILCLLLLMIVTVLVTNIFQCIQEKHQRQEILRNCSEKYIMQNDNYLKEQILTNKTLKYDVLKNSFQQKKELDSRLIQKNRCHRENEIVFKVLQNTGKFSEDHGSCCGVNCYYFTMQKKDWKGCKQTCQHCRSSLLKIDDKDELVFYIHFYSLGLCFSMLDLRYTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name KLRA1P killer cell lectin like receptor A1, pseudogene [ Homo sapiens (human) ]
Official Symbol KLRA1P
Synonyms KLRA1P; killer cell lectin like receptor A1, pseudogene; Ly49; KLRA1; LY49L; KLRAP1; Ly-49L; killer cell lectin-like receptor subfamily A pseudogene 1; killer cell lectin-like receptor subfamily A, member 1, pseudogene; MGC126520; MGC126522
Gene ID 10748
mRNA Refseq NM_006611
Protein Refseq NP_006602
MIM 604274

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All KLRA1P Products

Required fields are marked with *

My Review for All KLRA1P Products

Required fields are marked with *

0

Inquiry Basket

cartIcon