Recombinant Human KLKB1 Protein (20-390 aa), His-tagged
| Cat.No. : | KLKB1-2202H |
| Product Overview : | Recombinant Human KLKB1 Protein (20-390 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | The enzyme cleaves Lys-Arg and Arg-Ser bonds. It activates, in a reciprocal reaction, factor XII after its binding to a negatively charged surface. It also releases bradykinin from HMW kininogen and may also play a role in the renin-angiotensin system by converting prorenin into renin. |
| Source : | Yeast |
| Species : | Human |
| Tag : | His |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 43.4 kDa |
| Protein length : | 20-390 aa |
| AA Sequence : | GCLTQLYENAFFRGGDVASMYTPNAQYCQMRCTFHPRCLLFSFLPASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVDMRGVNFNVSKVSSVEECQKRCTNNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIKVLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFFTFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGVDFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCFLRLSMDGSPTRIAYGTQGSSGYSLRLCNTGDNSVCTTKTSTR |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | KLKB1 kallikrein B, plasma (Fletcher factor) 1 [ Homo sapiens ] |
| Official Symbol | KLKB1 |
| Synonyms | KLKB1; KLK3; plasma kallikrein; kininogenin; Fletcher factor; plasma prekallikrein; PPK; |
| Gene ID | 3818 |
| mRNA Refseq | NM_000892 |
| Protein Refseq | NP_000883 |
| MIM | 229000 |
| UniProt ID | P03952 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KLKB1 Products
Required fields are marked with *
My Review for All KLKB1 Products
Required fields are marked with *
0
Inquiry Basket
