Recombinant Human KLK7 Protein, GST-tagged

• Cat.No.: KLK7-4930H
• Product Overview: Human KLK7 full-length ORF ( NP_005037.1, 1 a.a. - 253 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its encoded enzyme is thought to be involved in the proteolysis of intercellular cohesive structures preceding desquamation, which is the shedding of the outermost layer of the epidermis. Alternative splicing of this gene results in two transcript variants encoding the same protein. [provided by RefSeq
• Molecular Mass: 53.90 kDa
• AA Sequence: MARSLLLPLQILLLSLALETAGEEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: KLK7 kallikrein-related peptidase 7 [ Homo sapiens ]
• Official Symbol: KLK7
• Synonyms: KLK7; kallikrein-related peptidase 7; kallikrein 7 (chymotryptic, stratum corneum) , PRSS6; kallikrein-7; SCCE; signal protein; serine protease 6; stratum corneum chymotryptic enzyme; kallikrein 7 (chymotryptic, stratum corneum); hK7; PRSS6
• Gene ID: 5650
• mRNA Refseq: NM_001243126
• Protein Refseq: NP_001230055
• MIM: 604438
• UniProt ID: P49862