Recombinant Human KLK2, His-tagged

• Cat.No.: KLK2-122H
• Product Overview: Recombinant Human Kallikrein 2/KLK2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Pro19-Pro261) of Human KLK2 fused with a polyhistidine tag at the C-terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 19-261 a.a.
• Description: Kallikrein-2 (KLK2) is a secreted serine protease that belongs to the peptidase S1 family of Kallikrein subfamily. KLK2 contains 1 peptidase S1 domain. It is highly expressed in the human prostate gland. KLK2 can cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin, but Preferential cleavages of Arg-|-Xaa bonds in small molecule substrates. It also highly selective action to release kallidin (lysyl-bradykinin) from kininogen involves hydrolysis of Met-|-Xaa or Leu-|-Xaa. KLK2 is inhibited by serpins such as protein C inhibitor, antichymotrypsin, and plasminogen. KLK2 is considered to be a biomarker for prostate cancer.
• Form: Supplied as a 0.2 μM filtered solution of 20mM Citrate, 150mM NaCl, pH 3.5
• AA Sequence: PLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEP EDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPAL GTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDS GGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANPVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Store at Please minimize freeze-thaw cycles.

Gene Information

• Gene Name: KLK2 kallikrein-related peptidase 2 [ Homo sapiens ]
• Official Symbol: KLK2
• Synonyms: KLK2; kallikrein-related peptidase 2; kallikrein 2, prostatic; kallikrein-2; tissue kallikrein-2; glandular kallikrein 2; glandular kallikrein-1; hK2; hGK-1; KLK2A2; FLJ17010; FLJ17011; MGC12201
• Gene ID: 3817
• mRNA Refseq: NM_001002231
• Protein Refseq: NP_001002231
• MIM: 147960
• UniProt ID: P20151
• Chromosome Location: 19q13.33
• Pathway: Activation of Matrix Metalloproteinases, organism-specific biosystem; Coregulation of Androgen receptor activity, organism-specific biosystem; Degradation of the extracellular matrix, organism-specific biosystem; Endocrine and other factor-regulated calcium reabsorption, organism-specific biosystem; Endocrine and other factor-regulated calcium reabsorption, conserved biosystem; Extracellular matrix organization, organism-specific biosystem; Regulation of Androgen receptor activity, organism-specific biosystem
• Function: peptidase activity; serine-type endopeptidase activity