Recombinant Human KITLG, StrepII-tagged

• Cat.No.: KITLG-262H
• Product Overview: Purified, full-length human recombinant KITLG or Kit ligand protein (amino acids 26-279, 254 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 18.5 kDa. (Accession NP_000890.1; UniProt P21583)

Specification

• Description: KITLG is the ligand of the tyrosine-kinase receptor encoded by the KIT. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis.
• Source: Human Cells
• Species: Human
• Tag: StrepII
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• Protein length: 26-279, 254 a.a.
• AA Sequence: EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDL KKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAA
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >95% pure by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: KITLG KIT ligand [ Homo sapiens ]
• Official Symbol: KITLG
• Synonyms: KITLG; KIT ligand; MGF; kit ligand; familial progressive hyperpigmentation 2; FPH2; Kitl; KL 1; mast cell growth factor; SCF; SF; steel factor; stem cell factor; c-Kit ligand; KL-1; SHEP7; kit-ligand; DKFZp686F2250
• Gene ID: 4254
• mRNA Refseq: NM_000899
• Protein Refseq: NP_000890
• MIM: 184745
• UniProt ID: P21583
• Chromosome Location: 12q22
• Pathway: C-MYB transcription factor network, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Kit Receptor Signaling Pathway, organism-specific biosystem; Melanogenesis, organism-specific biosystem
• Function: cytokine activity; growth factor activity; protein binding; stem cell factor receptor binding