Active Recombinant Mouse Kitl Protein

Cat.No. : Kitl-198M
Product Overview : Recombinant Mouse Kitl Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Stem cell factor (SCF) is a cytokine made by fibroblasts and endothelial cells. SCF binds to the receptor c-Kit/CD117 and plays a critical role in the maintenance, survival, and differentiation of hematopoietic stem cells. While human SCF shows no activity on murine cells, murine and rat SCF are active on human cells.
Bio-activity : TF-1 cell proliferation, ≤20 ng/mL
Molecular Mass : Monomer, 18.4 kDa (165 aa)
AA Sequence : MKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 20 mM sodium phosphate, pH 6.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name Kitl kit ligand [ Mus musculus (house mouse) ]
Official Symbol Kitl
Synonyms KITL; kit ligand; cloud gray; C-kit ligand; Steel factor; grizzle-belly; stem cell factor; mast cell growth factor; hematopoietic growth factor KL; Gb; SF; Sl; Clo; Con; Mgf; SCF; SLF; Kitlg; contrasted;
Gene ID 17311
mRNA Refseq NM_013598
Protein Refseq NP_038626
UniProt ID P20826

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Kitlg Products

Required fields are marked with *

My Review for All Kitlg Products

Required fields are marked with *

0

Inquiry Basket

cartIcon