Recombinant Human KIR3DL1 Protein, C-His-tagged

• Cat.No.: KIR3DL1-084H
• Product Overview: Recombinant Human KIR3DL1 Protein with C-His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: KIR3DL1, receptor on natural killer (NK) cells for HLA Bw4 allele. Inhibits the activity of NK cells thus preventing cell lysis.
• Molecular Mass: ~35 kDa
• AA Sequence: HMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHIPIFHGRIFQESFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNPRHLH
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Notes: For research use only, not for use in diagnostic procedure.
• Storage: Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
• Concentration: ≥0.5 mg/mL
• Storage Buffer: PBS, 4M Urea, pH7.4

Gene Information

• Gene Name: KIR3DL1 killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 1 [ Homo sapiens (human) ]
• Official Symbol: KIR3DL1
• Synonyms: KIR3DL1; killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 1; KIR; killer cell immunoglobulin-like receptor 3DL1; AMB11; CD158e1; CD158e1/2; CD158e2; cl 2; cl 11; nkat3; NKB1; NKB1B; NKAT-3; NK-receptor; KIR antigen 3DL1; killer Ig receptor; p70 NK receptor CL-2/CL-11; MHC class I NK cell receptor; CD158 antigen-like family member E; p70 killer cell inhibitory receptor; natural killer-associated transcript 3; HLA-BW4-specific inhibitory NK cell receptor; p70 natural killer cell receptor clones CL-2/CL-11; NKAT3; CD158E1; KIR3DL1/S1; MGC119726; MGC119728; MGC126589; MGC126591
• Gene ID: 3811
• mRNA Refseq: NM_013289
• Protein Refseq: NP_037421
• MIM: 604946
• UniProt ID: P43629