Recombinant Full Length Human Killer Cell Immunoglobulin-Like Receptor 3Dl1(Kir3Dl1) Protein, His-Tagged
Cat.No. : | RFL12281HF |
Product Overview : | Recombinant Full Length Human Killer cell immunoglobulin-like receptor 3DL1(KIR3DL1) Protein (P43629) (22-444aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (22-444) |
Form : | Lyophilized powder |
AA Sequence : | HMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHIPIFHGRIFQESFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNPRHLHILIGTSVVIILFILLLFFLLHLWCSNKKNAAVMDQEPAGNRTANSEDSDEQDPEEVTYAQLDHCVFTQRKITRPSQRPKTPPTDTILYTELPNAKPRSKVVSCP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KIR3DL1 |
Synonyms | KIR3DL1; CD158E; NKAT3; NKB1; Killer cell immunoglobulin-like receptor 3DL1; CD158 antigen-like family member E; HLA-BW4-specific inhibitory NK cell receptor; MHC class I NK cell receptor; Natural killer-associated transcript 3; NKAT-3; p70 natural killer |
UniProt ID | P43629 |
◆ Recombinant Proteins | ||
YJZG-3432B | Recombinant Bacillus subtilis YJZG protein, His-tagged | +Inquiry |
GK-332E | Active Recombinant E. coli Glycerol Kinase Protein, His-tagged | +Inquiry |
CSF3-777P | Recombinant Pig CSF3 protein, His-tagged | +Inquiry |
KIAA0913-1511H | Recombinant Human KIAA0913 | +Inquiry |
CCL11-149S | Recombinant Swine CCL11 | +Inquiry |
◆ Native Proteins | ||
LOX-41 | Active Native Lactate Oxidase | +Inquiry |
Thrombin-29B | Active Native Bovine alpha-Thrombin-FPRck | +Inquiry |
FSME-07 | Native FSME (TBE) Virus Antigen | +Inquiry |
PDHB-1860B | Native Bovine Pyruvate Dehydrogenase (lipoamide) Beta | +Inquiry |
toxB-11C | Native C. difficile toxB | +Inquiry |
◆ Cell & Tissue Lysates | ||
CEACAM1-3039HCL | Recombinant Human CEACAM1 cell lysate | +Inquiry |
SGCD-1888HCL | Recombinant Human SGCD 293 Cell Lysate | +Inquiry |
NHLH2-3832HCL | Recombinant Human NHLH2 293 Cell Lysate | +Inquiry |
Lung-316G | Guinea Pig Lung Lysate | +Inquiry |
RTN4-2121HCL | Recombinant Human RTN4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KIR3DL1 Products
Required fields are marked with *
My Review for All KIR3DL1 Products
Required fields are marked with *
0
Inquiry Basket