Recombinant Human KIR2DS2 Protein, C-His-tagged

• Cat.No.: KIR2DS2-002H
• Product Overview: Recombinant Human KIR2DS2 Protein with C-His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: KIR2DS2, receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.
• Molecular Mass: ~25 kDa
• AA Sequence: HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFEHFLLHREGKYKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Notes: For research use only, not for use in diagnostic procedure.
• Storage: Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
• Concentration: ≥0.5 mg/mL
• Storage Buffer: PBS, 4M Urea, pH7.4

Gene Information

• Gene Name: KIR2DS2 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 2 [ Homo sapiens (human) ]
• Official Symbol: KIR2DS2
• Synonyms: KIR2DS2; killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 2; killer cell immunoglobulin-like receptor 2DS2; 183ActI; CD158J; cl 49; nkat5; NKAT-5; p58 KIR; 1060P11.9.2; NK receptor 183 ActI; p58 NK receptor CL-49; MHC class I NK cell receptor; killer-cell Ig-like receptor; CD158 antigen-like family member J; natural killer associated transcript 5; natural killer-associated transcript 5; natural killer cell inhibitory receptor; p58 killer cell inhibitory receptor KIR-K7a; p58 natural killer cell receptor clone CL-49; killer-cell immunoglobulin-like receptor two domains short tail 2 protein; NKAT5; cl-49; CD158b; MGC120018; MGC120020; MGC149477; MGC149478
• Gene ID: 100132285
• mRNA Refseq: NM_012312
• Protein Refseq: NP_036444
• MIM: 604953
• UniProt ID: P43631