Recombinant Full Length Human Killer Cell Immunoglobulin-Like Receptor 2Ds2(Kir2Ds2) Protein, His-Tagged

• Cat.No.: RFL5330HF
• Product Overview: Recombinant Full Length Human Killer cell immunoglobulin-like receptor 2DS2(KIR2DS2) Protein (P43631) (22-304aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: Full Length of Mature Protein (22-304)
• Form: Lyophilized powder
• AA Sequence: HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFEHFLLHREGKYKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLHVLIGTSVVKIPFTILLFFLLHRWCSNKKNAAVMDQEPAGNRTVNSEDSDEQDHQEVSYA
• Purity: Greater than 90% as determined by SDS-PAGE.
• Applications: SDS-PAGE
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: KIR2DS2
• Synonyms: KIR2DS2; CD158J; NKAT5; Killer cell immunoglobulin-like receptor 2DS2; CD158 antigen-like family member J; MHC class I NK cell receptor; NK receptor 183 ActI; Natural killer-associated transcript 5; NKAT-5; p58 natural killer cell receptor clone CL-49; p5
• UniProt ID: P43631