Recombinant Human KIR2DS1 Protein (22-245 aa), His-tagged

• Cat.No.: KIR2DS1-1663H
• Product Overview: Recombinant Human KIR2DS1 Protein (22-245 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial.

Specification

• Description: Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.
• Source: Yeast
• Species: Human
• Tag: His
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 26.8 kDa
• Protein length: 22-245 aa
• AA Sequence: HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMRQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGTFQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: KIR2DS1 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1 [ Homo sapiens ]
• Official Symbol: KIR2DS1
• Synonyms: KIR2DS1; CD158H; EB6ActI; EB6ActII; KIR2DL1-KIR2DS1; p50.1; CD158a
• Gene ID: 3806
• mRNA Refseq: NM_014512
• Protein Refseq: NP_055327
• MIM: 604952
• UniProt ID: Q14954