Recombinant Human KIR2DS1 Protein (22-245 aa), His-tagged
Cat.No. : | KIR2DS1-1014H |
Product Overview : | Recombinant Human KIR2DS1 Protein (22-245 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 22-245 aa |
Description : | Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 28.8 kDa |
AA Sequence : | HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMRQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGTFQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | KIR2DS1 killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1 [ Homo sapiens ] |
Official Symbol | KIR2DS1 |
Synonyms | KIR2DS1; CD158H; EB6ActI; EB6ActII; KIR2DL1-KIR2DS1; p50.1; CD158a; |
Gene ID | 3806 |
mRNA Refseq | NM_014512 |
Protein Refseq | NP_055327 |
MIM | 604952 |
UniProt ID | Q14954 |
◆ Recombinant Proteins | ||
KIR2DS1-1663H | Recombinant Human KIR2DS1 Protein (22-245 aa), His-tagged | +Inquiry |
KIR2DS1-1014H | Recombinant Human KIR2DS1 Protein (22-245 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KIR2DS1 Products
Required fields are marked with *
My Review for All KIR2DS1 Products
Required fields are marked with *
0
Inquiry Basket