Recombinant Human KIR2DL2 Protein, C-His-tagged

• Cat.No.: KIR2DL2-081H
• Product Overview: Recombinant Human KIR2DL2 Protein with C-His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: NKAT (NK-associated transcripts) gene products, known as killer immunoglobulin-like receptors or KIRs, downregulate the cytotoxicity of NK cells upon recognition of specific class I major histocompatibility complex (MHC) molecules on target cells. This family of receptors is characterized by an extracellular region with two to three immunoglobulin-superfamily domains and a cytoplasmic domain with an antigen receptor activation motif (ARAM). KIRs and other inhibitory receptors also possess a common cytoplasmic sequence (I/VxYxxL/V) known as an ITIM (immunoreceptor tyrosine-based inhibitory motif). The human inhibitory natural killer cell immunoglobulin-like receptor 2DL1, also designated KIR2DL1, CL-42, NKAT1, P58.1 or CD158a long form, is a 348 amino acid type I transmembrane protein. KIR2DL1 can bind human leukocyte antigen-C (HLA-C) via both polar and hydrophobic interactions through Met 44 in a binding pocket that coordinates Lys 80 of HLA-C.
• Molecular Mass: ~25 kDa
• AA Sequence: HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHECRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVIGNPSNSWPSPTEPSSKTGNPRHLH
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Notes: For research use only, not for use in diagnostic procedure.
• Storage: Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
• Concentration: ≥0.5 mg/mL
• Storage Buffer: PBS, 4M Urea, pH7.4

Gene Information

• Gene Name: KIR2DL2 killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 2 [ Homo sapiens (human) ]
• Official Symbol: KIR2DL2
• Synonyms: KIR2DL2; killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 2; killer cell immunoglobulin-like receptor 2DL2; CD158B1; CD158k; cl 43; nkat6; NKAT-6; p58 NK receptor CL-43; MHC class I NK cell receptor; CD158 antigen-like family member B1; natural killer-associated transcript 6; p58 natural killer cell receptor clone CL-43; NKAT6; p58.2; CD158b
• Gene ID: 3803
• mRNA Refseq: NM_014219
• Protein Refseq: NP_055034
• MIM: 604937
• UniProt ID: P43627