Recombinant Full Length Human Killer Cell Immunoglobulin-Like Receptor 2Dl2(Kir2Dl2) Protein, His-Tagged

• Cat.No.: RFL5473HF
• Product Overview: Recombinant Full Length Human Killer cell immunoglobulin-like receptor 2DL2(KIR2DL2) Protein (P43627) (22-348aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Source: E.coli expression system
• Species: Homo sapiens (Human)
• Tag: His
• Form: Lyophilized powder
• Protein length: Full Length of Mature Protein (22-348)
• AA Sequence: HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHECRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVIGNPSNSWPSPTEPSSKTGNPRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEVTYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYAELPNAESRSKVVSCP
• Purity: Greater than 90% as determined by SDS-PAGE.
• Applications: SDS-PAGE
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: KIR2DL2
• Synonyms: KIR2DL2; CD158B1; NKAT6; Killer cell immunoglobulin-like receptor 2DL2; CD158 antigen-like family member B1; MHC class I NK cell receptor; Natural killer-associated transcript 6; NKAT-6; p58 natural killer cell receptor clone CL-43; p58 NK receptor CL-43
• UniProt ID: P43627